Lineage for d1h70a_ (1h70 A:)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) Superfamily d.126.1: Pentein [55909] (3 families) 
Family d.126.1.3: Dimethylarginine dimethylaminohydrolase DDAH [64380] (1 protein) Protein Dimethylarginine dimethylaminohydrolase DDAH [64381] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [64382] (1 PDB entry) 
Domain d1h70a_: 1h70 A: [60711]
Details for d1h70a_
PDB Entry: 1h70 (more details), 1.8 Å
PDB Description: ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline
SCOP Domain Sequences for d1h70a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h70a_ d.126.1.3 (A:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa}
fmfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfp
dsvfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdim
mvgdhfyigesartnaegarqmiailekhglsgsvvrlekvlhlktglaylehnnllaag
efvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtse
yrkidggvssmslrf
SCOP Domain Coordinates for d1h70a_:
Click to download the PDB-style file with coordinates for d1h70a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h70a_:
- d1h70a_ is new in SCOP 1.57
- d1h70a_ appears in SCOP 1.59
- d1h70a_ appears in the current release, SCOPe 2.08
View in 3D