![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Mammalian thioredoxin reductase [63947] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [63948] (1 PDB entry) |
![]() | Domain d1h6vf2: 1h6v F:171-292 [60709] Other proteins in same PDB: d1h6va3, d1h6vb3, d1h6vc3, d1h6vd3, d1h6ve3, d1h6vf3 complexed with fad, ndp; mutant |
PDB Entry: 1h6v (more details), 3 Å
SCOP Domain Sequences for d1h6vf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6vf2 c.3.1.5 (F:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus)} pgdkeycissddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdq dmankigehmeehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvlla vg
Timeline for d1h6vf2: