SCOP 1.71: Domain d1h6ve3: 1h6v E:367-499

Lineage for d1h6ve3 (1h6v E:367-499)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family)
   both first two domains are of same beta/beta/alpha fold

5. Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)

6. Protein Mammalian thioredoxin reductase [64329] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [64330] (1 PDB entry)

8. Domain d1h6ve3: 1h6v E:367-499 [60707]
   Other proteins in same PDB: d1h6va1, d1h6va2, d1h6vb1, d1h6vb2, d1h6vc1, d1h6vc2, d1h6vd1, d1h6vd2, d1h6ve1, d1h6ve2, d1h6vf1, d1h6vf2

Details for d1h6ve3

PDB Entry: 1h6v, 3 Å

PDB Description: mammalian thioredoxin reductase

SCOP Domain Sequences for d1h6ve3:

Sequence; same for both SEQRES and ATOM records:

>d1h6ve3 d.87.1.1 (E:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus)}
ydnvpttvftpleygccglseekavekfgeenievyhsffwplewtvpsrdnnkcyakvi
cnlkdnervvgfhvlgpnagevtqgfaaalkcgltkqqldstigihpvcaeifttlsvtk
rsggdilqsgccg

Timeline for d1h6ve3:

• d1h6ve3 first appeared in SCOP 1.57
  
• d1h6ve3 appears in SCOP 1.69
  
• d1h6ve3 appears in SCOP 1.73
  
• d1h6ve3 appears in the current release, SCOPe 2.08