Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) |
Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins) |
Protein Mammalian thioredoxin reductase [63947] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [63948] (1 PDB entry) |
Domain d1h6ve2: 1h6v E:171-292 [60706] Other proteins in same PDB: d1h6va3, d1h6vb3, d1h6vc3, d1h6vd3, d1h6ve3, d1h6vf3 |
PDB Entry: 1h6v (more details), 3 Å
SCOP Domain Sequences for d1h6ve2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ve2 c.3.1.5 (E:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus)} pgdkeycissddlfslpycpgktlvvgasyvalecagflagigldvtvmvrsillrgfdq dmankigehmeehgikfirqfvptkieqieagtpgrlkvtakstnseetiedefntvlla vg
Timeline for d1h6ve2: