Lineage for d1h6vd1 (1h6v D:9-170,D:293-366)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 478897Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 478898Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 479223Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (13 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 479340Protein Mammalian thioredoxin reductase [63947] (1 species)
  7. 479341Species Rat (Rattus norvegicus) [TaxId:10116] [63948] (1 PDB entry)
  8. 479348Domain d1h6vd1: 1h6v D:9-170,D:293-366 [60702]
    Other proteins in same PDB: d1h6va3, d1h6vb3, d1h6vc3, d1h6vd3, d1h6ve3, d1h6vf3

Details for d1h6vd1

PDB Entry: 1h6v (more details), 3 Å

PDB Description: mammalian thioredoxin reductase

SCOP Domain Sequences for d1h6vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6vd1 c.3.1.5 (D:9-170,D:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus)}
ksydfdliiigggsgglaaakeaakfdkkvmvldfvtptplgtnwglggtcvnvgcipkk
lmhqaallgqalkdsrnygwkledtvkhdwekmtesvqnhigslnwgyrvalrekkvvye
naygkfigphkimatnnkgkekvysaerfliatgerprylgiXrdsctrtigletvgvki
nektgkipvtdeeqtnvpyiyaigdilegkleltpvaiqagrllaqrlyggstvkcd

SCOP Domain Coordinates for d1h6vd1:

Click to download the PDB-style file with coordinates for d1h6vd1.
(The format of our PDB-style files is described here.)

Timeline for d1h6vd1: