Class b: All beta proteins [48724] (180 folds) |
Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
Superfamily b.88.1: Mss4-like [51316] (5 families) duplication: tandem repeat of two similar structural motifs |
Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins) contains an insertion of alpha helical hairpin; lacks zinc-binding site automatically mapped to Pfam PF00838 |
Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [63875] (2 PDB entries) |
Domain d1h6qa_: 1h6q A: [60692] |
PDB Entry: 1h6q (more details)
SCOPe Domain Sequences for d1h6qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6qa_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} mllykdvisgdelvsdaydlkevddivyeadcqmvtvkqggdvdiganpsaedaeenaee gtetvnnlvysfrlsptsfdkksymsyikgymkaikarlqesnpervpvfeknaigfvkk ilanfkdydfyigesmdpdamvvlmnyredgitpymiffkdglvsekf
Timeline for d1h6qa_: