Lineage for d1h6qa_ (1h6q A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818899Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2818900Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2818910Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
    contains an insertion of alpha helical hairpin; lacks zinc-binding site
    automatically mapped to Pfam PF00838
  6. 2818911Protein Translationally controlled tumor protein TCTP (histamine-releasing factor) [63874] (3 species)
  7. 2818912Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [63875] (2 PDB entries)
  8. 2818913Domain d1h6qa_: 1h6q A: [60692]

Details for d1h6qa_

PDB Entry: 1h6q (more details)

PDB Description: translationally controlled tumor-associated protein p23fyp from schizosaccharomyces pombe
PDB Compounds: (A:) translationally controlled tumor protein

SCOPe Domain Sequences for d1h6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6qa_ b.88.1.2 (A:) Translationally controlled tumor protein TCTP (histamine-releasing factor) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mllykdvisgdelvsdaydlkevddivyeadcqmvtvkqggdvdiganpsaedaeenaee
gtetvnnlvysfrlsptsfdkksymsyikgymkaikarlqesnpervpvfeknaigfvkk
ilanfkdydfyigesmdpdamvvlmnyredgitpymiffkdglvsekf

SCOPe Domain Coordinates for d1h6qa_:

Click to download the PDB-style file with coordinates for d1h6qa_.
(The format of our PDB-style files is described here.)

Timeline for d1h6qa_: