Lineage for d1h6pa_ (1h6p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017350Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 2017351Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
    automatically mapped to Pfam PF08558
  5. 2017352Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (2 proteins)
  6. 2017359Protein TRF2 [63604] (1 species)
  7. 2017360Species Human (Homo sapiens) [TaxId:9606] [63605] (3 PDB entries)
  8. 2017361Domain d1h6pa_: 1h6p A: [60690]
    complexed with mg

Details for d1h6pa_

PDB Entry: 1h6p (more details), 2.2 Å

PDB Description: dimeristion domain from human trf2
PDB Compounds: (A:) telomeric repeat binding factor 2

SCOPe Domain Sequences for d1h6pa_:

Sequence, based on SEQRES records: (download)

>d1h6pa_ a.146.1.1 (A:) TRF2 {Human (Homo sapiens) [TaxId: 9606]}
agearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgkehtvsrllr
vmqclsrieegenldcsfdmeaeltplesainvlemikteftlteavvessrklvkeaav
iiciknkefekaskilkkhmskdpttqklrndllniireknlahpviqnfsyetfqqkml
rfleshlddaepylltmakkalk

Sequence, based on observed residues (ATOM records): (download)

>d1h6pa_ a.146.1.1 (A:) TRF2 {Human (Homo sapiens) [TaxId: 9606]}
agearleeavnrwvlkfyfhealrafrgsrygdfrqirdimqallvrplgvsrllrvmqc
lsrieegenlsfdmeaeltplesainvlemikteftlteavvessrklvkeaaviicikn
kefekaskilkkhmrndllniireknlahpviqnfsyetfqqkmlrfleshlddaepyll
tmakkalk

SCOPe Domain Coordinates for d1h6pa_:

Click to download the PDB-style file with coordinates for d1h6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1h6pa_: