Lineage for d1h6oa_ (1h6o A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017350Fold a.146: Telomeric repeat binding factor (TRF) dimerisation domain [63599] (1 superfamily)
    multihelical; can be divided into an alpha-alpha superhelix domain and a long alpha-hairpin dimerization domain
  4. 2017351Superfamily a.146.1: Telomeric repeat binding factor (TRF) dimerisation domain [63600] (1 family) (S)
    automatically mapped to Pfam PF08558
  5. 2017352Family a.146.1.1: Telomeric repeat binding factor (TRF) dimerisation domain [63601] (2 proteins)
  6. 2017353Protein TRF1 [63602] (1 species)
  7. 2017354Species Human (Homo sapiens) [TaxId:9606] [63603] (3 PDB entries)
  8. 2017358Domain d1h6oa_: 1h6o A: [60689]

Details for d1h6oa_

PDB Entry: 1h6o (more details), 2.9 Å

PDB Description: dimerisation domain from human trf1
PDB Compounds: (A:) telomeric repeat binding factor 1

SCOPe Domain Sequences for d1h6oa_:

Sequence, based on SEQRES records: (download)

>d1h6oa_ a.146.1.1 (A:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
edaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlr
tiyicqfltriaagktldaqfenderitplesalmiwgsiekehdklheeiqnlikiqai
avcmengnfkeaeevferifgdpnshmpfkskllmiisqkdtfhsffqhfsynhmmekik
syvnyvlseksstflmkaaakvve

Sequence, based on observed residues (ATOM records): (download)

>d1h6oa_ a.146.1.1 (A:) TRF1 {Human (Homo sapiens) [TaxId: 9606]}
edaglvaeaeavaagwmldflclslcrafrdgrsedfrrtrnsaeaiihglssltacqlr
tiyicqfltriaagktlqfenderitplesalmiwgsiekehdklheeiqnlikiqaiav
cmengnfkeaeevferifgdpskllmiisqkdtfhsffqhfsynhmmekiksyvnyvlse
ksstflmkaaakvve

SCOPe Domain Coordinates for d1h6oa_:

Click to download the PDB-style file with coordinates for d1h6oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h6oa_: