Lineage for d1h6ky_ (1h6k Y:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412350Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 412351Family d.58.7.1: Canonical RBD [54929] (20 proteins)
  6. 412352Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)
  7. 412353Species Human (Homo sapiens) [TaxId:9606] [64275] (6 PDB entries)
  8. 412355Domain d1h6ky_: 1h6k Y: [60685]
    Other proteins in same PDB: d1h6ka1, d1h6ka2, d1h6ka3, d1h6kb1, d1h6kb2, d1h6kb3, d1h6kc1, d1h6kc2, d1h6kc3

Details for d1h6ky_

PDB Entry: 1h6k (more details), 2 Å

PDB Description: nuclear cap binding complex

SCOP Domain Sequences for d1h6ky_:

Sequence, based on SEQRES records: (download)

>d1h6ky_ d.58.7.1 (Y:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens)}
ksctlyvgnlsfytteeqiyelfsksgdikkiimgldkmktacgfcfveyysradaenam
ryingtrlddriirtdwda

Sequence, based on observed residues (ATOM records): (download)

>d1h6ky_ d.58.7.1 (Y:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens)}
ksctlyvgnlsfytteeqiyelfsksgdikkiimgldkmcgfcfveyysradaenamryi
ngtrlddriirtdwda

SCOP Domain Coordinates for d1h6ky_:

Click to download the PDB-style file with coordinates for d1h6ky_.
(The format of our PDB-style files is described here.)

Timeline for d1h6ky_: