Lineage for d1h6kc1 (1h6k C:26-290)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50498Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 50499Superfamily a.118.1: ARM repeat [48371] (9 families) (S)
  5. 50540Family a.118.1.2: HEAT repeat [48385] (3 proteins)
    this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain
  6. 50541Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
  7. 50542Species Human (Homo sapiens) [TaxId:9606] [63607] (1 PDB entry)
  8. 50549Domain d1h6kc1: 1h6k C:26-290 [60681]
    Other proteins in same PDB: d1h6kx_, d1h6ky_, d1h6kz_

Details for d1h6kc1

PDB Entry: 1h6k (more details), 2 Å

PDB Description: nuclear cap binding complex

SCOP Domain Sequences for d1h6kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6kc1 a.118.1.2 (C:26-290) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens)}
etedhleslickvgeksacslesnleglagvleadlpnykskilrllctvarllpeklti
yttlvgllnarnynfggefveamirqlkeslkannyneavylvrflsdlvnchviaapsm
vamfenfvsvtqeedvpqvrrdwyvyaflsslpwvgkelyekkdaemdrifantesylkr
rqkthvpmlqvwtadkphpqeeyldclwaqiqklkkdrwqerhilrpylafdsilcealq
hnlppftppphtedsvypmprvifr

SCOP Domain Coordinates for d1h6kc1:

Click to download the PDB-style file with coordinates for d1h6kc1.
(The format of our PDB-style files is described here.)

Timeline for d1h6kc1: