SCOPe 2.06: Domain d1h6gb2: 1h6g B:508-632

Lineage for d1h6gb2 (1h6g B:508-632)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein alpha-catenin [47222] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63511] (1 PDB entry)

8. Domain d1h6gb2: 1h6g B:508-632 [60672]
   middle domain; contains two domains of this fold
   complexed with ca, cl, mpd

Details for d1h6gb2

PDB Entry: 1h6g, 2.2 Å

PDB Description: alpha-catenin m-domain

PDB Compounds: (B:) alpha-1 catenin

SCOPe Domain Sequences for d1h6gb2:

Sequence; same for both SEQRES and ATOM records:

>d1h6gb2 a.24.9.1 (B:508-632) alpha-catenin {Human (Homo sapiens) [TaxId: 9606]}
iddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdnyepgv
ytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasrlvydgirdirk
avlmi

Timeline for d1h6gb2:

• d1h6gb2 first appeared in SCOP 1.57
  
• d1h6gb2 appears in SCOPe 2.05
  
• d1h6gb2 appears in SCOPe 2.07
  
• d1h6gb2 appears in the current release, SCOPe 2.08