Lineage for d1h6ga1 (1h6g A:377-507)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46463Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies)
  4. 46647Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) (S)
  5. 46648Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
  6. 46649Protein alpha-catenin [47222] (2 species)
  7. 46650Species Human (Homo sapiens) [TaxId:9606] [63511] (1 PDB entry)
  8. 46651Domain d1h6ga1: 1h6g A:377-507 [60669]

Details for d1h6ga1

PDB Entry: 1h6g (more details), 2.2 Å

PDB Description: alpha-catenin m-domain

SCOP Domain Sequences for d1h6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ga1 a.24.9.1 (A:377-507) alpha-catenin {Human (Homo sapiens)}
dlrrqlrkavmdhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanl
acsisnneegvklvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvr
vltdavddits

SCOP Domain Coordinates for d1h6ga1:

Click to download the PDB-style file with coordinates for d1h6ga1.
(The format of our PDB-style files is described here.)

Timeline for d1h6ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h6ga2