Lineage for d1h69c_ (1h69 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838601Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 1838615Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 1838616Species Human (Homo sapiens) [TaxId:9606] [52239] (8 PDB entries)
  8. 1838627Domain d1h69c_: 1h69 C: [60667]
    complexed with arh, fad

Details for d1h69c_

PDB Entry: 1h69 (more details), 1.86 Å

PDB Description: crystal structure of human nad[p]h-quinone oxidoreductase co with 2,3,5,6,tetramethyl-p-benzoquinone (duroquinone) at 2.5 angstrom resolution
PDB Compounds: (C:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d1h69c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h69c_ c.23.5.3 (C:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]}
agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
evqdeeknkkfglsvghhlgksiptdnqikark

SCOPe Domain Coordinates for d1h69c_:

Click to download the PDB-style file with coordinates for d1h69c_.
(The format of our PDB-style files is described here.)

Timeline for d1h69c_: