Lineage for d1h66d_ (1h66 D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120383Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 120474Family c.23.5.3: Quinone reductase [52235] (2 proteins)
  6. 120475Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 120476Species Human (Homo sapiens) [TaxId:9606] [52239] (8 PDB entries)
  8. 120492Domain d1h66d_: 1h66 D: [60663]

Details for d1h66d_

PDB Entry: 1h66 (more details), 2 Å

PDB Description: crystal structure of human nad[p]h-quinone oxidoreductase co with 2,5-diaziridinyl-3-hydroxyl-6-methyl-1,4-benzoquinone

SCOP Domain Sequences for d1h66d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h66d_ c.23.5.3 (D:) NAD(P)H:quinone reductase {Human (Homo sapiens)}
agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
evqdeeknkkfglsvghhlgksiptdnqikark

SCOP Domain Coordinates for d1h66d_:

Click to download the PDB-style file with coordinates for d1h66d_.
(The format of our PDB-style files is described here.)

Timeline for d1h66d_: