SCOPe 2.07: Domain d1h66a_: 1h66 A:

Lineage for d1h66a_ (1h66 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein NAD(P)H:quinone reductase [52236] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52239] (9 PDB entries)

8. Domain d1h66a_: 1h66 A: [60660]
   complexed with fad, rh1

Details for d1h66a_

PDB Entry: 1h66, 2 Å

PDB Description: crystal structure of human nad[p]h-quinone oxidoreductase co with 2,5-diaziridinyl-3-hydroxyl-6-methyl-1,4-benzoquinone

PDB Compounds: (A:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d1h66a_:

Sequence; same for both SEQRES and ATOM records:

>d1h66a_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]}
agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
evqdeeknkkfglsvghhlgksiptdnqikark

Timeline for d1h66a_:

• d1h66a_ first appeared in SCOP 1.57
  
• d1h66a_ appears in SCOPe 2.06
  
• d1h66a_ appears in the current release, SCOPe 2.08