Lineage for d1h66a_ (1h66 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.3: Quinone reductase [52235] (2 proteins) Protein NAD(P)H:quinone reductase [52236] (3 species) Species Human (Homo sapiens) [TaxId:9606] [52239] (6 PDB entries) 
Domain d1h66a_: 1h66 A: [60660]
Details for d1h66a_
PDB Entry: 1h66 (more details), 2 Å
PDB Description: crystal structure of human nad[p]h-quinone oxidoreductase co with 2,5-diaziridinyl-3-hydroxyl-6-methyl-1,4-benzoquinone
SCOP Domain Sequences for d1h66a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h66a_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens)}
agrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklk
dpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervf
igefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcg
fqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkk
evqdeeknkkfglsvghhlgksiptdnqikark
SCOP Domain Coordinates for d1h66a_:
Click to download the PDB-style file with coordinates for d1h66a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h66a_:
- d1h66a_ is new in SCOP 1.57
- d1h66a_ appears in SCOP 1.59
- d1h66a_ appears in the current release, SCOPe 2.08
View in 3D
