Lineage for d1h63a_ (1h63 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305374Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 305375Family c.1.4.1: FMN-linked oxidoreductases [51396] (12 proteins)
  6. 305481Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 305482Species Enterobacter cloacae [TaxId:550] [63901] (9 PDB entries)
  8. 305489Domain d1h63a_: 1h63 A: [60659]
    complexed with fmn

Details for d1h63a_

PDB Entry: 1h63 (more details), 1.62 Å

PDB Description: Structure of the reduced Pentaerythritol Tetranitrate Reductase

SCOP Domain Sequences for d1h63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h63a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae}
saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
ypsl

SCOP Domain Coordinates for d1h63a_:

Click to download the PDB-style file with coordinates for d1h63a_.
(The format of our PDB-style files is described here.)

Timeline for d1h63a_: