SCOP 1.67: Domain d1h62a_: 1h62 A:

Lineage for d1h62a_ (1h62 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (15 proteins)

6. Protein Pentaerythritol tetranirate reductase [63900] (1 species)

7. Species Enterobacter cloacae [TaxId:550] [63901] (10 PDB entries)

8. Domain d1h62a_: 1h62 A: [60658]
   complexed with anb, fmn

Details for d1h62a_

PDB Entry: 1h62, 1.9 Å

PDB Description: structure of pentaerythritol tetranitrate reductase in complex with 1, 4-androstadien-3,17-dione

SCOP Domain Sequences for d1h62a_:

Sequence; same for both SEQRES and ATOM records:

>d1h62a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae}
saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
ypsl

Timeline for d1h62a_:

• d1h62a_ first appeared in SCOP 1.57
  
• d1h62a_ appears in SCOP 1.65
  
• d1h62a_ appears in SCOP 1.69
  
• d1h62a_ appears in the current release, SCOPe 2.08