Lineage for d1h62a_ (1h62 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64537Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 64538Family c.1.4.1: FMN-linked oxidoreductases [51396] (9 proteins)
  6. 64602Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 64603Species Enterobacter cloacae [TaxId:550] [63901] (5 PDB entries)
  8. 64608Domain d1h62a_: 1h62 A: [60658]

Details for d1h62a_

PDB Entry: 1h62 (more details), 1.9 Å

PDB Description: structure of pentaerythritol tetranitrate reductase in complex with 1, 4-androstadien-3,17-dione

SCOP Domain Sequences for d1h62a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h62a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae}
saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
ypsl

SCOP Domain Coordinates for d1h62a_:

Click to download the PDB-style file with coordinates for d1h62a_.
(The format of our PDB-style files is described here.)

Timeline for d1h62a_: