SCOPe 2.08: Domain d1h61a_: 1h61 A:

Lineage for d1h61a_ (1h61 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Pentaerythritol tetranirate reductase [63900] (1 species)

7. Species Enterobacter cloacae [TaxId:550] [63901] (33 PDB entries)
   Uniprot P71278

8. Domain d1h61a_: 1h61 A: [60657]
   complexed with fmn, pdn
   has additional insertions and/or extensions that are not grouped together

Details for d1h61a_

PDB Entry: 1h61, 1.4 Å

PDB Description: Structure of Pentaerythritol Tetranitrate Reductase in complex with prednisone

PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d1h61a_:

Sequence; same for both SEQRES and ATOM records:

>d1h61a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
ypsl

Timeline for d1h61a_:

• d1h61a_ first appeared in SCOP 1.57
  
• d1h61a_ appears in SCOPe 2.07