![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein Pentaerythritol tetranirate reductase [63900] (1 species) |
![]() | Species Enterobacter cloacae [TaxId:550] [63901] (33 PDB entries) Uniprot P71278 |
![]() | Domain d1h61a_: 1h61 A: [60657] complexed with fmn, pdn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1h61 (more details), 1.4 Å
SCOPe Domain Sequences for d1h61a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h61a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd ypsl
Timeline for d1h61a_: