SCOPe 2.05: Domain d1h60a_: 1h60 A:

Lineage for d1h60a_ (1h60 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Pentaerythritol tetranirate reductase [63900] (1 species)

7. Species Enterobacter cloacae [TaxId:550] [63901] (27 PDB entries)
   Uniprot P71278

8. Domain d1h60a_: 1h60 A: [60656]
   complexed with fmn, str

Details for d1h60a_

PDB Entry: 1h60, 1.6 Å

PDB Description: Structure of Pentaerythritol Tetranitrate Reductase in complex with progesterone

PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d1h60a_:

Sequence; same for both SEQRES and ATOM records:

>d1h60a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
ypsl

Timeline for d1h60a_:

• d1h60a_ first appeared in SCOP 1.57
  
• d1h60a_ appears in SCOPe 2.04
  
• d1h60a_ appears in SCOPe 2.06
  
• d1h60a_ appears in the current release, SCOPe 2.08