Lineage for d1h60a_ (1h60 A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (9 proteins) Protein Pentaerythritol tetranirate reductase [63900] (1 species) Species Enterobacter cloacae [TaxId:550] [63901] (5 PDB entries) 
Domain d1h60a_: 1h60 A: [60656]
Details for d1h60a_
PDB Entry: 1h60 (more details), 1.6 Å
PDB Description: Structure of Pentaerythritol Tetranitrate Reductase in complex with progesterone
SCOP Domain Sequences for d1h60a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h60a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae}
saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
ypsl
SCOP Domain Coordinates for d1h60a_:
Click to download the PDB-style file with coordinates for d1h60a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h60a_:
- d1h60a_ is new in SCOP 1.57
- d1h60a_ appears in SCOP 1.59
- d1h60a_ appears in the current release, SCOPe 2.08
View in 3D