Lineage for d1h5ql_ (1h5q L:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66476Protein Mannitol dehydrogenase [63927] (1 species)
  7. 66477Species Mushroom (Agaricus bisporus) [TaxId:5341] [63928] (1 PDB entry)
  8. 66489Domain d1h5ql_: 1h5q L: [60654]

Details for d1h5ql_

PDB Entry: 1h5q (more details), 1.5 Å

PDB Description: mannitol dehydrogenase from agaricus bisporus

SCOP Domain Sequences for d1h5ql_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5ql_ c.2.1.2 (L:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus)}
pgftisfvnktiivtggnrgiglaftravaaaganvaviyrsaadavevtekvgkefgvk
tkayqcdvsntdivtktiqqidadlgpisglianagvsvvkpatelthedfafvydvnvf
gvfntcravaklwlqkqqkgsivvtssmssqiinqsslngsltqvfynsskaacsnlvkg
laaewasagirvnalspgyvntdqtahmdkkirdhqasniplnrfaqpeemtgqaillls
dhatymtggeyfidggqliw

SCOP Domain Coordinates for d1h5ql_:

Click to download the PDB-style file with coordinates for d1h5ql_.
(The format of our PDB-style files is described here.)

Timeline for d1h5ql_: