Lineage for d1h5qk_ (1h5q K:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827903Protein Mannitol dehydrogenase [63927] (1 species)
  7. 1827904Species Mushroom (Agaricus bisporus) [TaxId:5341] [63928] (1 PDB entry)
  8. 1827915Domain d1h5qk_: 1h5q K: [60653]
    complexed with nap, ni

Details for d1h5qk_

PDB Entry: 1h5q (more details), 1.5 Å

PDB Description: mannitol dehydrogenase from agaricus bisporus
PDB Compounds: (K:) nadp-dependent mannitol dehydrogenase

SCOPe Domain Sequences for d1h5qk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5qk_ c.2.1.2 (K:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]}
pgftisfvnktiivtggnrgiglaftravaaaganvaviyrsaadavevtekvgkefgvk
tkayqcdvsntdivtktiqqidadlgpisglianagvsvvkpatelthedfafvydvnvf
gvfntcravaklwlqkqqkgsivvtssmssqiinqsslngsltqvfynsskaacsnlvkg
laaewasagirvnalspgyvntdqtahmdkkirdhqasniplnrfaqpeemtgqaillls
dhatymtggeyfidggqliw

SCOPe Domain Coordinates for d1h5qk_:

Click to download the PDB-style file with coordinates for d1h5qk_.
(The format of our PDB-style files is described here.)

Timeline for d1h5qk_: