Lineage for d1h5qc_ (1h5q C:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820470Protein Mannitol dehydrogenase [63927] (1 species)
  7. 820471Species Mushroom (Agaricus bisporus) [TaxId:5341] [63928] (1 PDB entry)
  8. 820474Domain d1h5qc_: 1h5q C: [60645]

Details for d1h5qc_

PDB Entry: 1h5q (more details), 1.5 Å

PDB Description: mannitol dehydrogenase from agaricus bisporus
PDB Compounds: (C:) nadp-dependent mannitol dehydrogenase

SCOP Domain Sequences for d1h5qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5qc_ c.2.1.2 (C:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]}
pgftisfvnktiivtggnrgiglaftravaaaganvaviyrsaadavevtekvgkefgvk
tkayqcdvsntdivtktiqqidadlgpisglianagvsvvkpatelthedfafvydvnvf
gvfntcravaklwlqkqqkgsivvtssmssqiinqsslngsltqvfynsskaacsnlvkg
laaewasagirvnalspgyvntdqtahmdkkirdhqasniplnrfaqpeemtgqaillls
dhatymtggeyfidggqliw

SCOP Domain Coordinates for d1h5qc_:

Click to download the PDB-style file with coordinates for d1h5qc_.
(The format of our PDB-style files is described here.)

Timeline for d1h5qc_: