Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Mannitol dehydrogenase [63927] (1 species) |
Species Mushroom (Agaricus bisporus) [TaxId:5341] [63928] (1 PDB entry) |
Domain d1h5qc_: 1h5q C: [60645] |
PDB Entry: 1h5q (more details), 1.5 Å
SCOP Domain Sequences for d1h5qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h5qc_ c.2.1.2 (C:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} pgftisfvnktiivtggnrgiglaftravaaaganvaviyrsaadavevtekvgkefgvk tkayqcdvsntdivtktiqqidadlgpisglianagvsvvkpatelthedfafvydvnvf gvfntcravaklwlqkqqkgsivvtssmssqiinqsslngsltqvfynsskaacsnlvkg laaewasagirvnalspgyvntdqtahmdkkirdhqasniplnrfaqpeemtgqaillls dhatymtggeyfidggqliw
Timeline for d1h5qc_: