Lineage for d1h5pa_ (1h5p A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115799Fold b.99: SAND domain [63762] (1 superfamily)
  4. 115800Superfamily b.99.1: SAND domain [63763] (1 family) (S)
  5. 115801Family b.99.1.1: SAND domain [63764] (1 protein)
  6. 115802Protein Nuclear autoantigen Sp100b [63765] (1 species)
  7. 115803Species Human (Homo sapiens) [TaxId:9606] [63766] (1 PDB entry)
  8. 115804Domain d1h5pa_: 1h5p A: [60642]

Details for d1h5pa_

PDB Entry: 1h5p (more details)

PDB Description: solution structure of the human sp100b sand domain by heteronuclear nmr.

SCOP Domain Sequences for d1h5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5pa_ b.99.1.1 (A:) Nuclear autoantigen Sp100b {Human (Homo sapiens)}
mdeninfkqselpvtcgevkgtlykerfkqgtskkciqsedkkwftprefeiegdrgask
nwklsircggytlkvlmenkflpeppstrkkvtik

SCOP Domain Coordinates for d1h5pa_:

Click to download the PDB-style file with coordinates for d1h5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1h5pa_: