Lineage for d1h5pa_ (1h5p A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006848Fold d.217: SAND domain-like [63762] (1 superfamily)
    core: three short helices packed against a barrel-like beta-sheet; some similarity to the SH3-like fold
  4. 3006849Superfamily d.217.1: SAND domain-like [63763] (2 families) (S)
  5. 3006850Family d.217.1.1: SAND domain [63764] (3 proteins)
    automatically mapped to Pfam PF01342
  6. 3006855Protein Nuclear autoantigen Sp100b [63765] (1 species)
  7. 3006856Species Human (Homo sapiens) [TaxId:9606] [63766] (1 PDB entry)
  8. 3006857Domain d1h5pa_: 1h5p A: [60642]
    CASP4

Details for d1h5pa_

PDB Entry: 1h5p (more details)

PDB Description: solution structure of the human sp100b sand domain by heteronuclear nmr.
PDB Compounds: (A:) nuclear autoantigen sp100-b

SCOPe Domain Sequences for d1h5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5pa_ d.217.1.1 (A:) Nuclear autoantigen Sp100b {Human (Homo sapiens) [TaxId: 9606]}
mdeninfkqselpvtcgevkgtlykerfkqgtskkciqsedkkwftprefeiegdrgask
nwklsircggytlkvlmenkflpeppstrkkvtik

SCOPe Domain Coordinates for d1h5pa_:

Click to download the PDB-style file with coordinates for d1h5pa_.
(The format of our PDB-style files is described here.)

Timeline for d1h5pa_: