Lineage for d1h5bd_ (1h5b D:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein T-cell antigen receptor [48933] (6 species) 
Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (11 PDB entries) 
Domain d1h5bd_: 1h5b D: [60641]
Details for d1h5bd_
PDB Entry: 1h5b (more details), 1.85 Å
PDB Description: t cell receptor valpha11 (av11s5) domain
SCOP Domain Sequences for d1h5bd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h5bd_ b.1.1.1 (D:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmp
SCOP Domain Coordinates for d1h5bd_:
Click to download the PDB-style file with coordinates for d1h5bd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h5bd_:
- d1h5bd_ is new in SCOP 1.57
- d1h5bd_ appears in SCOP 1.59
- d1h5bd_ appears in the current release, SCOPe 2.08
View in 3D
