Lineage for d1h5bc_ (1h5b C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 103212Protein T-cell antigen receptor [48933] (6 species)
  7. 103239Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (12 PDB entries)
  8. 103242Domain d1h5bc_: 1h5b C: [60640]

Details for d1h5bc_

PDB Entry: 1h5b (more details), 1.85 Å

PDB Description: t cell receptor valpha11 (av11s5) domain

SCOP Domain Sequences for d1h5bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5bc_ b.1.1.1 (C:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaaeassgswqlifgsgtqltvmpvt

SCOP Domain Coordinates for d1h5bc_:

Click to download the PDB-style file with coordinates for d1h5bc_.
(The format of our PDB-style files is described here.)

Timeline for d1h5bc_: