| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (22 PDB entries) |
| Domain d1h5bb_: 1h5b B: [60639] AV11S5-AJ17 complexed with cl, gol |
PDB Entry: 1h5b (more details), 1.85 Å
SCOPe Domain Sequences for d1h5bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h5bb_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmpv
Timeline for d1h5bb_: