Lineage for d1h5bb_ (1h5b B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 52846Protein T-cell antigen receptor [48933] (6 species)
  7. 52873Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (11 PDB entries)
  8. 52875Domain d1h5bb_: 1h5b B: [60639]

Details for d1h5bb_

PDB Entry: 1h5b (more details), 1.85 Å

PDB Description: t cell receptor valpha11 (av11s5) domain

SCOP Domain Sequences for d1h5bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h5bb_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
gdqveqspsalslhegtdsalrcnftttmrsvqwfrqnsrgslislfylasgtkengrlk
safdskerrystlhirdaqledsgtyfcaaeassgawqlifgsgtqltvmp

SCOP Domain Coordinates for d1h5bb_:

Click to download the PDB-style file with coordinates for d1h5bb_.
(The format of our PDB-style files is described here.)

Timeline for d1h5bb_: