Class b: All beta proteins [48724] (177 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.3: Glycosyltransferase family 36 N-terminal domain [63733] (2 proteins) overall domain organization is similar to Bacterial glucoamylase |
Protein Lactobacillus maltose phosphorylase, N-terminal domain [63734] (1 species) |
Species Lactobacillus brevis [TaxId:1580] [63735] (1 PDB entry) |
Domain d1h54b2: 1h54 B:1-268 [60637] Other proteins in same PDB: d1h54a1, d1h54b1 complexed with k, po4 |
PDB Entry: 1h54 (more details), 2.15 Å
SCOPe Domain Sequences for d1h54b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h54b2 b.30.5.3 (B:1-268) Lactobacillus maltose phosphorylase, N-terminal domain {Lactobacillus brevis [TaxId: 1580]} mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea nyderfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekev ttaytgklapqasaelekrvivvtsrdy
Timeline for d1h54b2: