![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.4: Glycosyltransferase family 36 C-terminal domain [63588] (2 proteins) overall domain organization is similar to Bacterial glucoamylase |
![]() | Protein Lactobacillus maltose phosphorylase, central domain [63589] (1 species) includes alpha-helical linker to the N-terminal domain and a small C-terminal beta-sandwich subdomain |
![]() | Species Lactobacillus brevis [TaxId:1580] [63590] (1 PDB entry) |
![]() | Domain d1h54b1: 1h54 B:269-754 [60636] Other proteins in same PDB: d1h54a2, d1h54b2 complexed with k, po4 |
PDB Entry: 1h54 (more details), 2.15 Å
SCOPe Domain Sequences for d1h54b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h54b1 a.102.1.4 (B:269-754) Lactobacillus maltose phosphorylase, central domain {Lactobacillus brevis [TaxId: 1580]} dtqesltaamhqlsdkvaqssyedllnahtaiwaqrweksdvvikgddesqqgirfnlfq lfstyygedarlnigpkgftgekyggatywdteafafpvylgitdpkvtrnllmyrykql dgayinaqeqglkgalfpmvtfdgiechneweitfeeihrngdiafaiynytrytgddsy vlhegakvlteisrfwadrvhfskrnnqymihgvtgadeyennvdnnwdtnmlaqwtlky tleilgkvdqdtakqldvsdeektkwqdivdrmylpydkdlnifvqhdgfldkdiepvss ipadqrpinqnwswdkilrspyikqgdvlqgiwdfiddytpeqkkanfdfyepltvhess lspaihsvlaadlhyedkavelysrtarldldnynndttdglhitsmtgawiavvqgfag mrvrdgqlhyapflpktwtsytfrqvfrdrlievsvhadgphfkllsgepltidvagaaa aaaaaa
Timeline for d1h54b1: