SCOPe 2.02: Domain d1h54b1: 1h54 B:269-754

Lineage for d1h54b1 (1h54 B:269-754)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.4: Glycosyltransferase family 36 C-terminal domain [63588] (2 proteins)
   overall domain organization is similar to Bacterial glucoamylase

6. Protein Lactobacillus maltose phosphorylase, central domain [63589] (1 species)
   includes alpha-helical linker to the N-terminal domain and a small C-terminal beta-sandwich subdomain

7. Species Lactobacillus brevis [TaxId:1580] [63590] (1 PDB entry)

8. Domain d1h54b1: 1h54 B:269-754 [60636]
   Other proteins in same PDB: d1h54a2, d1h54b2
   complexed with k, po4

Details for d1h54b1

PDB Entry: 1h54, 2.15 Å

PDB Description: Maltose phosphorylase from Lactobacillus brevis

PDB Compounds: (B:) maltose phosphorylase

SCOPe Domain Sequences for d1h54b1:

Sequence; same for both SEQRES and ATOM records:

>d1h54b1 a.102.1.4 (B:269-754) Lactobacillus maltose phosphorylase, central domain {Lactobacillus brevis [TaxId: 1580]}
dtqesltaamhqlsdkvaqssyedllnahtaiwaqrweksdvvikgddesqqgirfnlfq
lfstyygedarlnigpkgftgekyggatywdteafafpvylgitdpkvtrnllmyrykql
dgayinaqeqglkgalfpmvtfdgiechneweitfeeihrngdiafaiynytrytgddsy
vlhegakvlteisrfwadrvhfskrnnqymihgvtgadeyennvdnnwdtnmlaqwtlky
tleilgkvdqdtakqldvsdeektkwqdivdrmylpydkdlnifvqhdgfldkdiepvss
ipadqrpinqnwswdkilrspyikqgdvlqgiwdfiddytpeqkkanfdfyepltvhess
lspaihsvlaadlhyedkavelysrtarldldnynndttdglhitsmtgawiavvqgfag
mrvrdgqlhyapflpktwtsytfrqvfrdrlievsvhadgphfkllsgepltidvagaaa
aaaaaa

Timeline for d1h54b1:

• d1h54b1 first appeared in SCOP 1.57
  
• d1h54b1 appears in SCOPe 2.01
  
• d1h54b1 appears in SCOPe 2.03
  
• d1h54b1 appears in the current release, SCOPe 2.08