Lineage for d1h54b1 (1h54 B:269-754)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004206Family a.102.1.4: Glycosyltransferase family 36 C-terminal domain [63588] (2 protein domains)
    overall domain organization is similar to Bacterial glucoamylase
  6. 2004212Protein Lactobacillus maltose phosphorylase, central domain [63589] (1 species)
    includes alpha-helical linker to the N-terminal domain and a small C-terminal beta-sandwich subdomain
  7. 2004213Species Lactobacillus brevis [TaxId:1580] [63590] (1 PDB entry)
  8. 2004215Domain d1h54b1: 1h54 B:269-754 [60636]
    Other proteins in same PDB: d1h54a2, d1h54b2
    complexed with k, po4

Details for d1h54b1

PDB Entry: 1h54 (more details), 2.15 Å

PDB Description: Maltose phosphorylase from Lactobacillus brevis
PDB Compounds: (B:) maltose phosphorylase

SCOPe Domain Sequences for d1h54b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h54b1 a.102.1.4 (B:269-754) Lactobacillus maltose phosphorylase, central domain {Lactobacillus brevis [TaxId: 1580]}
dtqesltaamhqlsdkvaqssyedllnahtaiwaqrweksdvvikgddesqqgirfnlfq
lfstyygedarlnigpkgftgekyggatywdteafafpvylgitdpkvtrnllmyrykql
dgayinaqeqglkgalfpmvtfdgiechneweitfeeihrngdiafaiynytrytgddsy
vlhegakvlteisrfwadrvhfskrnnqymihgvtgadeyennvdnnwdtnmlaqwtlky
tleilgkvdqdtakqldvsdeektkwqdivdrmylpydkdlnifvqhdgfldkdiepvss
ipadqrpinqnwswdkilrspyikqgdvlqgiwdfiddytpeqkkanfdfyepltvhess
lspaihsvlaadlhyedkavelysrtarldldnynndttdglhitsmtgawiavvqgfag
mrvrdgqlhyapflpktwtsytfrqvfrdrlievsvhadgphfkllsgepltidvagaaa
aaaaaa

SCOPe Domain Coordinates for d1h54b1:

Click to download the PDB-style file with coordinates for d1h54b1.
(The format of our PDB-style files is described here.)

Timeline for d1h54b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h54b2