Lineage for d1h54a2 (1h54 A:1-268)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58106Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 58208Superfamily b.30.4: Lactobacillus maltose phosphorylase, N-terminal domain [63732] (1 family) (S)
  5. 58209Family b.30.4.1: Lactobacillus maltose phosphorylase, N-terminal domain [63733] (1 protein)
  6. 58210Protein Lactobacillus maltose phosphorylase, N-terminal domain [63734] (1 species)
  7. 58211Species Lactobacillus brevis [63735] (1 PDB entry)
  8. 58212Domain d1h54a2: 1h54 A:1-268 [60635]
    Other proteins in same PDB: d1h54a1, d1h54b1

Details for d1h54a2

PDB Entry: 1h54 (more details), 2.15 Å

PDB Description: Maltose phosphorylase from Lactobacillus brevis

SCOP Domain Sequences for d1h54a2:

Sequence, based on SEQRES records: (download)

>d1h54a2 b.30.4.1 (A:1-268) Lactobacillus maltose phosphorylase, N-terminal domain {Lactobacillus brevis}
mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
nyderfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekev
ttaytgklapqasaelekrvivvtsrdy

Sequence, based on observed residues (ATOM records): (download)

>d1h54a2 b.30.4.1 (A:1-268) Lactobacillus maltose phosphorylase, N-terminal domain {Lactobacillus brevis}
mkrifevqpwnvithtfdpkdkrlqesmtslgngymgmrgdfeegysgdslqgiylggvw
ypdktrvgwwkngypkyfgkvvnavnfiklpieingepvdlakdkisdftldldmhqgvl
nrsfvvergavrvalnfqrflsvaqpelsvqkvtvknlsdaevdvtlkpsidadvmneea
nydrfwdvlatdqqadrgsivakttpnpfgtprftsgmemrlvtdlknvaitqpnekevt
taytgklapqasaelekrvivvtsrdy

SCOP Domain Coordinates for d1h54a2:

Click to download the PDB-style file with coordinates for d1h54a2.
(The format of our PDB-style files is described here.)

Timeline for d1h54a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h54a1