Lineage for d1h54a1 (1h54 A:269-753)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50021Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 50022Superfamily a.102.1: Six-hairpin glycosyltransferases [48208] (4 families) (S)
  5. 50064Family a.102.1.4: Lactobacillus maltose phosphorylase, central domain [63588] (1 protein)
  6. 50065Protein Lactobacillus maltose phosphorylase, central domain [63589] (1 species)
  7. 50066Species Lactobacillus brevis [63590] (1 PDB entry)
  8. 50067Domain d1h54a1: 1h54 A:269-753 [60634]
    Other proteins in same PDB: d1h54a2, d1h54b2

Details for d1h54a1

PDB Entry: 1h54 (more details), 2.15 Å

PDB Description: Maltose phosphorylase from Lactobacillus brevis

SCOP Domain Sequences for d1h54a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h54a1 a.102.1.4 (A:269-753) Lactobacillus maltose phosphorylase, central domain {Lactobacillus brevis}
dtqesltaamhqlsdkvaqssyedllnahtaiwaqrweksdvvikgddesqqgirfnlfq
lfstyygedarlnigpkgftgekyggatywdteafafpvylgitdpkvtrnllmyrykql
dgayinaqeqglkgalfpmvtfdgiechneweitfeeihrngdiafaiynytrytgddsy
vlhegakvlteisrfwadrvhfskrnnqymihgvtgadeyennvdnnwdtnmlaqwtlky
tleilgkvdqdtakqldvsdeektkwqdivdrmylpydkdlnifvqhdgfldkdiepvss
ipadqrpinqnwswdkilrspyikqgdvlqgiwdfiddytpeqkkanfdfyepltvhess
lspaihsvlaadlhyedkavelysrtarldldnynndttdglhitsmtgawiavvqgfag
mrvrdgqlhyapflpktwtsytfrqvfrdrlievsvhadgphfkllsgepltidvagaaa
aaaaa

SCOP Domain Coordinates for d1h54a1:

Click to download the PDB-style file with coordinates for d1h54a1.
(The format of our PDB-style files is described here.)

Timeline for d1h54a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h54a2