Lineage for d1h53a_ (1h53 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174511Protein Angiogenin [54094] (2 species)
  7. 2174515Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries)
  8. 2174528Domain d1h53a_: 1h53 A: [60633]
    complexed with cit, po4

Details for d1h53a_

PDB Entry: 1h53 (more details), 2 Å

PDB Description: Binding of Phosphate and Pyrophosphate ions at the active site of human Angiogenin as revealed by X-ray Crystallography
PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d1h53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h53a_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng
nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldgsifrr
p

SCOPe Domain Coordinates for d1h53a_:

Click to download the PDB-style file with coordinates for d1h53a_.
(The format of our PDB-style files is described here.)

Timeline for d1h53a_: