Lineage for d1h4za_ (1h4z A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099015Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2099063Superfamily c.13.2: SpoIIaa-like [52091] (2 families) (S)
  5. 2099064Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
    automatically mapped to Pfam PF01740
  6. 2099065Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)
  7. 2099066Species Bacillus sphaericus [TaxId:1421] [63953] (3 PDB entries)
  8. 2099071Domain d1h4za_: 1h4z A: [60630]
    unphosphorylated form

Details for d1h4za_

PDB Entry: 1h4z (more details), 2.74 Å

PDB Description: structure of the anti-sigma factor antagonist spoiiaa in its unphosphorylated form
PDB Compounds: (A:) anti-sigma f factor antagonist

SCOPe Domain Sequences for d1h4za_:

Sequence, based on SEQRES records: (download)

>d1h4za_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Bacillus sphaericus [TaxId: 1421]}
afqlemvtretvvirlfgeldhhaveqirakistaifqgavttiiwnferlsfmdssgvg
lvlgrmreleavagrtillnpsptmrkvfqfsglgpwmmdateeeaidrvrgi

Sequence, based on observed residues (ATOM records): (download)

>d1h4za_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Bacillus sphaericus [TaxId: 1421]}
afqlemvtretvvirlfgeldhhaveqirakistaifqgavttiiwnferlsfmdssgvg
lvlgrmreleavagrtillnpsptmrkvfqfgpwmmdateeeaidrvrgi

SCOPe Domain Coordinates for d1h4za_:

Click to download the PDB-style file with coordinates for d1h4za_.
(The format of our PDB-style files is described here.)

Timeline for d1h4za_: