Lineage for d1h4yb_ (1h4y B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835156Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 1835204Superfamily c.13.2: SpoIIaa-like [52091] (2 families) (S)
  5. 1835205Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
    automatically mapped to Pfam PF01740
  6. 1835206Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)
  7. 1835207Species Bacillus sphaericus [TaxId:1421] [63953] (3 PDB entries)
  8. 1835211Domain d1h4yb_: 1h4y B: [60629]
    unphosphorylated form

Details for d1h4yb_

PDB Entry: 1h4y (more details), 1.61 Å

PDB Description: structure of the anti-sigma factor antagonist spoiiaa in its unphosphorylated form
PDB Compounds: (B:) anti-sigma f factor antagonist

SCOPe Domain Sequences for d1h4yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4yb_ c.13.2.1 (B:) Anti-sigma factor antagonist SpoIIaa {Bacillus sphaericus [TaxId: 1421]}
afqlemvtretvvirlfgeldhhaveqirakistaifqgavttiiwnferlsfmdssgvg
lvlgrmreleavagrtillnpsptvrkvfqfsglgpwmmdateeeaidrvrgivn

SCOPe Domain Coordinates for d1h4yb_:

Click to download the PDB-style file with coordinates for d1h4yb_.
(The format of our PDB-style files is described here.)

Timeline for d1h4yb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h4ya_