SCOPe 2.05: Domain d1h4ya_: 1h4y A:

Lineage for d1h4ya_ (1h4y A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.2: SpoIIaa-like [52091] (2 families)

5. Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
   automatically mapped to Pfam PF01740

6. Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)

7. Species Bacillus sphaericus [TaxId:1421] [63953] (3 PDB entries)

8. Domain d1h4ya_: 1h4y A: [60628]
   unphosphorylated form

Details for d1h4ya_

PDB Entry: 1h4y, 1.61 Å

PDB Description: structure of the anti-sigma factor antagonist spoiiaa in its unphosphorylated form

PDB Compounds: (A:) anti-sigma f factor antagonist

SCOPe Domain Sequences for d1h4ya_:

Sequence; same for both SEQRES and ATOM records:

>d1h4ya_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Bacillus sphaericus [TaxId: 1421]}
afqlemvtretvvirlfgeldhhaveqirakistaifqgavttiiwnferlsfmdssgvg
lvlgrmreleavagrtillnpsptvrkvfqfsglgpwmmdateeeaidrvrgivn

Timeline for d1h4ya_:

• d1h4ya_ first appeared in SCOP 1.57
  
• d1h4ya_ appears in SCOPe 2.04
  
• d1h4ya_ appears in SCOPe 2.06
  
• d1h4ya_ appears in the current release, SCOPe 2.08