Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
Superfamily c.13.2: SpoIIaa-like [52091] (2 families) |
Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein) automatically mapped to Pfam PF01740 |
Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species) |
Species Bacillus sphaericus [TaxId:1421] [63953] (3 PDB entries) |
Domain d1h4ya_: 1h4y A: [60628] unphosphorylated form |
PDB Entry: 1h4y (more details), 1.61 Å
SCOPe Domain Sequences for d1h4ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4ya_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Bacillus sphaericus [TaxId: 1421]} afqlemvtretvvirlfgeldhhaveqirakistaifqgavttiiwnferlsfmdssgvg lvlgrmreleavagrtillnpsptvrkvfqfsglgpwmmdateeeaidrvrgivn
Timeline for d1h4ya_: