![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) ![]() |
![]() | Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
![]() | Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries) |
![]() | Domain d1h4vb1: 1h4v B:326-421 [60624] Other proteins in same PDB: d1h4vb2 complexed with so4 |
PDB Entry: 1h4v (more details), 2.4 Å
SCOP Domain Sequences for d1h4vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4vb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg edelragevtlkrlatgeqvrlsreevpgyllqalg
Timeline for d1h4vb1: