Lineage for d1h4ua1 (1h4u A:399-631)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165330Family d.22.1.2: Domain G2 of nidogen-1 [64244] (1 protein)
    automatically mapped to Pfam PF07474
  6. 2165331Protein Domain G2 of nidogen-1 [64245] (1 species)
  7. 2165332Species Mouse (Mus musculus) [TaxId:10090] [64246] (2 PDB entries)
  8. 2165334Domain d1h4ua1: 1h4u A:399-631 [60622]
    Other proteins in same PDB: d1h4ua2

Details for d1h4ua1

PDB Entry: 1h4u (more details), 2.2 Å

PDB Description: domain g2 of mouse nidogen-1
PDB Compounds: (A:) nidogen-1

SCOPe Domain Sequences for d1h4ua1:

Sequence, based on SEQRES records: (download)

>d1h4ua1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}
gspqrvngkvkgrifvgssqvpvvfentdlhsyvvmnhgrsytaistipetvgysllpla
piggiigwmfaveqdgfkngfsitggeftrqaevtflghpgklvlkqqfsgidehghlti
stelegrvpqipygasvhiepytelyhysssvitssstreytvmepdqdgaapshthiyq
wrqtitfqecahddarpalpstqqlsvdsvfvlynkeerilryalsnsigpvr

Sequence, based on observed residues (ATOM records): (download)

>d1h4ua1 d.22.1.2 (A:399-631) Domain G2 of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]}
gspqrvngkvkgrifvgssqvpvvfentdlhsyvvmnhgrsytaistipetvgysllpla
piggiigwmfaveqdgfkngfsitggeftrqaevtflghpgklvlkqqfsgidehghlti
stelegrvpqipygasvhiepytelyhysssvitssstreytvmeppshthiyqwrqtit
fqecpalpstqqlsvdsvfvlynkeerilryalsnsigpvr

SCOPe Domain Coordinates for d1h4ua1:

Click to download the PDB-style file with coordinates for d1h4ua1.
(The format of our PDB-style files is described here.)

Timeline for d1h4ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h4ua2