Lineage for d1h4tc3 (1h4t C:404-477)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726532Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 726646Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) (S)
    contains a metal (zinc)-binding site
  5. 726647Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 726648Protein C-terminal domain of ProRS [64588] (3 species)
  7. 726659Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)
  8. 726668Domain d1h4tc3: 1h4t C:404-477 [60618]
    Other proteins in same PDB: d1h4ta1, d1h4ta2, d1h4tb1, d1h4tb2, d1h4tc1, d1h4tc2, d1h4td1, d1h4td2

Details for d1h4tc3

PDB Entry: 1h4t (more details), 2.9 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with l-proline
PDB Compounds: (C:) prolyl-tRNA synthetase

SCOP Domain Sequences for d1h4tc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4tc3 d.68.5.1 (C:404-477) C-terminal domain of ProRS {Thermus thermophilus [TaxId: 274]}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

SCOP Domain Coordinates for d1h4tc3:

Click to download the PDB-style file with coordinates for d1h4tc3.
(The format of our PDB-style files is described here.)

Timeline for d1h4tc3: