Lineage for d1h4sb2 (1h4s B:5-276)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920823Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species)
  7. 1920834Species Thermus thermophilus [TaxId:274] [64348] (4 PDB entries)
  8. 1920844Domain d1h4sb2: 1h4s B:5-276 [60608]
    Other proteins in same PDB: d1h4sa1, d1h4sa3, d1h4sb1, d1h4sb3
    protein/RNA complex; complexed with psd, so4, zn

Details for d1h4sb2

PDB Entry: 1h4s (more details), 2.85 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with trnapro(cgg) and a prolyl-adenylate analogue
PDB Compounds: (B:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1h4sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4sb2 d.104.1.1 (B:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]}
kgltpqsqdfsewyleviqkaeladygpvrgtivvrpygyaiweniqqvldrmfketghq
nayfplfipmsflrkeaehvegfspelavvthaggeeleeplavrptsetvigymwskwi
rswrdlpqllnqwgnvvrwemrtrpflrtseflwqeghtahatreeaeeevrrmlsiyar
lareyaaipvieglktekekfagavytttiealmkdgkalqagtshylgenfarafdikf
qdrdlqvkyvhttswglswrfigaiimthgdd

SCOPe Domain Coordinates for d1h4sb2:

Click to download the PDB-style file with coordinates for d1h4sb2.
(The format of our PDB-style files is described here.)

Timeline for d1h4sb2: