SCOPe 2.02: Domain d1h4sb2: 1h4s B:5-276

Lineage for d1h4sb2 (1h4s B:5-276)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Prolyl-tRNA synthetase (ProRS) [64347] (3 species)

7. Species Thermus thermophilus [TaxId:274] [64348] (4 PDB entries)

8. Domain d1h4sb2: 1h4s B:5-276 [60608]
   Other proteins in same PDB: d1h4sa1, d1h4sa3, d1h4sb1, d1h4sb3
   protein/RNA complex; complexed with psd, so4, zn

Details for d1h4sb2

PDB Entry: 1h4s, 2.85 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with trnapro(cgg) and a prolyl-adenylate analogue

PDB Compounds: (B:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1h4sb2:

Sequence; same for both SEQRES and ATOM records:

>d1h4sb2 d.104.1.1 (B:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]}
kgltpqsqdfsewyleviqkaeladygpvrgtivvrpygyaiweniqqvldrmfketghq
nayfplfipmsflrkeaehvegfspelavvthaggeeleeplavrptsetvigymwskwi
rswrdlpqllnqwgnvvrwemrtrpflrtseflwqeghtahatreeaeeevrrmlsiyar
lareyaaipvieglktekekfagavytttiealmkdgkalqagtshylgenfarafdikf
qdrdlqvkyvhttswglswrfigaiimthgdd

Timeline for d1h4sb2:

• d1h4sb2 first appeared in SCOP 1.57
  
• d1h4sb2 appears in SCOPe 2.01
  
• d1h4sb2 appears in SCOPe 2.03
  
• d1h4sb2 appears in the current release, SCOPe 2.08