SCOP 1.67: Domain d1h4sb1: 1h4s B:277-403

Lineage for d1h4sb1 (1h4s B:277-403)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)

6. Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species)

7. Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries)

8. Domain d1h4sb1: 1h4s B:277-403 [60607]
   Other proteins in same PDB: d1h4sa2, d1h4sa3, d1h4sb2, d1h4sb3
   complexed with 5mu, psd, psu, so4, zn

Details for d1h4sb1

PDB Entry: 1h4s, 2.85 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with trnapro(cgg) and a prolyl-adenylate analogue

SCOP Domain Sequences for d1h4sb1:

Sequence; same for both SEQRES and ATOM records:

>d1h4sb1 c.51.1.1 (B:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh

Timeline for d1h4sb1:

• d1h4sb1 first appeared in SCOP 1.57
  
• d1h4sb1 appears in SCOP 1.65
  
• d1h4sb1 appears in SCOP 1.69
  
• d1h4sb1 appears in the current release, SCOPe 2.08