Lineage for d1h4qa3 (1h4q A:404-477)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1419300Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1419569Superfamily d.68.5: C-terminal domain of ProRS [64586] (1 family) (S)
    contains a metal (zinc)-binding site
  5. 1419570Family d.68.5.1: C-terminal domain of ProRS [64587] (1 protein)
  6. 1419571Protein C-terminal domain of ProRS [64588] (3 species)
  7. 1419582Species Thermus thermophilus [TaxId:274] [64589] (4 PDB entries)
  8. 1419593Domain d1h4qa3: 1h4q A:404-477 [60600]
    Other proteins in same PDB: d1h4qa1, d1h4qa2, d1h4qb1, d1h4qb2
    protein/RNA complex; complexed with atp, pri, so4, zn

Details for d1h4qa3

PDB Entry: 1h4q (more details), 3 Å

PDB Description: prolyl-trna synthetase from thermus thermophilus complexed with trnapro(cgg), atp and prolinol
PDB Compounds: (A:) prolyl-tRNA synthetase

SCOPe Domain Sequences for d1h4qa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4qa3 d.68.5.1 (A:404-477) C-terminal domain of ProRS {Thermus thermophilus [TaxId: 274]}
trkvdtyeafkeavqegfalafhcgdkacerliqeettattrcvpfeaepeegfcvrcgr
psaygkrvvfakay

SCOPe Domain Coordinates for d1h4qa3:

Click to download the PDB-style file with coordinates for d1h4qa3.
(The format of our PDB-style files is described here.)

Timeline for d1h4qa3: