Lineage for d1h4jc_ (1h4j C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1803668Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1803669Superfamily b.70.1: Quinoprotein alcohol dehydrogenase-like [50998] (2 families) (S)
  5. 1803670Family b.70.1.1: Quinoprotein alcohol dehydrogenase-like [50999] (4 proteins)
  6. 1803675Protein Methanol dehydrogenase, heavy chain [51000] (3 species)
  7. 1803676Species Methylobacterium extorquens [TaxId:408] [63834] (3 PDB entries)
    Uniprot P16027
  8. 1803682Domain d1h4jc_: 1h4j C: [60592]
    Other proteins in same PDB: d1h4jb_, d1h4jd_, d1h4jf_, d1h4jh_
    complexed with ca, pqq; mutant

Details for d1h4jc_

PDB Entry: 1h4j (more details), 3 Å

PDB Description: methylobacterium extorquens methanol dehydrogenase d303e mutant
PDB Compounds: (C:) methanol dehydrogenase subunit 1

SCOPe Domain Sequences for d1h4jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4jc_ b.70.1.1 (C:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]}
ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
eweyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
fmlpyragqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewk

SCOPe Domain Coordinates for d1h4jc_:

Click to download the PDB-style file with coordinates for d1h4jc_.
(The format of our PDB-style files is described here.)

Timeline for d1h4jc_: