SCOP 1.59: Domain d1h4ib_: 1h4i B:

Lineage for d1h4ib_ (1h4i B:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)

4. Superfamily a.137.2: Quinoprotein alcohol dehydrogenase [48666] (1 family)

5. Family a.137.2.1: Quinoprotein alcohol dehydrogenase [48667] (1 protein)

6. Protein Methanol dehydrogenase, light chain [48668] (2 species)

7. Species Methylobacterium extorquens [TaxId:408] [63633] (2 PDB entries)

8. Domain d1h4ib_: 1h4i B: [60587]
   Other proteins in same PDB: d1h4ia_, d1h4ic_

Details for d1h4ib_

PDB Entry: 1h4i, 1.94 Å

PDB Description: methylobacterium extorquens methanol dehydrogenase

SCOP Domain Sequences for d1h4ib_:

Sequence; same for both SEQRES and ATOM records:

>d1h4ib_ a.137.2.1 (B:) Methanol dehydrogenase, light chain {Methylobacterium extorquens}
ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
tgkfeydvakisa

Timeline for d1h4ib_:

• d1h4ib_ first appeared in SCOP 1.57
  
• d1h4ib_ appears in SCOP 1.61
  
• d1h4ib_ appears in the current release, SCOPe 2.08